PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA39G00623
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 316aa    MW: 37147.4 Da    PI: 7.5229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA39G00623genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-1685130147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+ +G+ +W++Ia++++ gR++k+c++rw++ 
       AA39G00623  85 RGHWRPAEDVKLKELVAIYGPQNWNLIAEKLQ-GRSGKSCRLRWFNQ 130
                      899*****************************.***********996 PP

2Myb_DNA-binding57.82.5e-18137180146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l +a++++G++ W+ Iar ++ gRt++++k++w+ 
       AA39G00623 137 RRAFSEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNSVKNHWHV 180
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.43980131IPR017930Myb domain
SMARTSM007173.9E-1484133IPR001005SANT/Myb domain
PfamPF002495.4E-1685130IPR001005SANT/Myb domain
SuperFamilySSF466893.29E-2885178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-2586138IPR009057Homeodomain-like
CDDcd001673.14E-1188129No hitNo description
PROSITE profilePS5129427.31132186IPR017930Myb domain
SMARTSM007178.4E-15136184IPR001005SANT/Myb domain
PfamPF002492.8E-15137179IPR001005SANT/Myb domain
CDDcd001673.77E-10139179No hitNo description
Gene3DG3DSA:1.10.10.603.6E-21139185IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MFMLEDQRWI NDRSKATSSW DFSYNTNHHE FDILKSSNED EFHQNTRIND QEIDSNSEST  60
KKERRESGSC GQSSSSSSKG TILGRGHWRP AEDVKLKELV AIYGPQNWNL IAEKLQGRSG  120
KSCRLRWFNQ LDPRINRRAF SEEEEERLMQ AHRLYGNKWA MIARLFPGRT DNSVKNHWHV  180
IMARKYREHS SAYRRRKLMI DHHPLNPNPN PNPNPNPNDP NYHVLIPNHH YFTHPFPEFN  240
YTNGFIPMPF HCFQGYESNE TSMVGDNIEM KSDVLLDHTM KETRTDVNEA VKWSVMGEVV  300
EKSKQQPYFF DFLGLG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-32831865108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002893381.11e-128T24P13.16
TrEMBLD7KQL71e-128D7KQL7_ARALL; T24P13.16
STRINGfgenesh1_pg.C_scaffold_10022871e-128(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26780.21e-114myb domain protein 117